qtqt5qgraphicsviewqgraphicssceneqgraphicsitem
QGraphicsItem: how to move it automatically with when QGraphicsScene resizes?
I have a QGraphicsScene and a few QGraphicsItem objects on it. It is a data flow diagram.
I want to tie a few objects (input and output ports) to scene borders, and when scene size changes, they should automatically move with the scene bord
Cannot you tell me, how can it be done?
Solution
Bind a method in the QGraphicsItem implementation to the sceneRectChanged signal of the scene object, and have that method adjust it's object's position to take into account the new scene rect.
Depending on what you are trying to do, you might need to keep a copy of the previous scene rect for reference so you can work out what the change is.
- pass two column values in a table as parameter in KDB function
- What is the explicit promise construction antipattern and how do I avoid it?
- Return value from list of list when criteria met in KDB
- Node.js recursive calls with q framework for multiple GET requests
- Convert a column of dictionary datatype to table in kdb
- Aren't promises just callbacks?
- Resolve promises one after another (i.e. in sequence)?
- kdb+/q When to actually reload the hdb?
- KDB Update dictionary column from a table
- How to check if an object is a Promise?
- Restify.js (Connect/Express) middleware ignoring call to next() within promise callback
- Automate the process of data cleaning and saving tables into CSV
- How to write KDB query output to a text file
- Kdb+ keyed table syntax in tick.q
- NodeJS My SQL query with Chain promise
- How to get resolved value/rejected error in finally block?
- Concat string with number in kdb+ q
- How does Angular $q.when work?
- Open window inside promise
- How to use .finally() without .then()?
- Limit Q promise concurrency in Node js
- AngularJS Promises, $q, defer
- Are there still reasons to use promise libraries like Q or BlueBird now that we have ES6 promises?
- MongoDB indexing , please explain difference between 1 and -1
- Serialize a list of js promises call
- Angular Js : '$q.defer is not a function' error
- Remove rows containing null values efficiently
- Select time windows across multiple days from datetime column
- Function to Convert decimals to percentage in KDB
- update where symbol length less than 3 characters KDB+/Q