qtqgraphicsviewqtstylesheetsqframe
How to make QGraphicsView Flat?
How can I make QGraphicsView look flat? It looks like this:
I don't want the outline to be shown. Thanks!
Solution
QGraphicsView inherits from QFrame. Use the setFrameStyle method and the lineWidth property to change the frame appearance.
- in KDB q, how do you write a custom mavg that drops the top 5 and bottom 5 results before doing moving average
- pass two column values in a table as parameter in KDB function
- What is the explicit promise construction antipattern and how do I avoid it?
- Return value from list of list when criteria met in KDB
- Node.js recursive calls with q framework for multiple GET requests
- Convert a column of dictionary datatype to table in kdb
- Aren't promises just callbacks?
- Resolve promises one after another (i.e. in sequence)?
- kdb+/q When to actually reload the hdb?
- KDB Update dictionary column from a table
- How to check if an object is a Promise?
- Restify.js (Connect/Express) middleware ignoring call to next() within promise callback
- Automate the process of data cleaning and saving tables into CSV
- How to write KDB query output to a text file
- Kdb+ keyed table syntax in tick.q
- NodeJS My SQL query with Chain promise
- How to get resolved value/rejected error in finally block?
- Concat string with number in kdb+ q
- How does Angular $q.when work?
- Open window inside promise
- How to use .finally() without .then()?
- Limit Q promise concurrency in Node js
- AngularJS Promises, $q, defer
- Are there still reasons to use promise libraries like Q or BlueBird now that we have ES6 promises?
- MongoDB indexing , please explain difference between 1 and -1
- Serialize a list of js promises call
- Angular Js : '$q.defer is not a function' error
- Remove rows containing null values efficiently
- Select time windows across multiple days from datetime column
- Function to Convert decimals to percentage in KDB