Search code examples
oracle-databasetriggersprimary-keyidentitysequences

How bad is it to simulate IDENTITY/AUTOINCREMENT columns using triggers in Oracle?


I maintain an application that was originally written to be SQL Server-specific (using IDENTITY fields). Thus, we've had to define a lot of triggers to auto increment tables' primary keys.

I'm told that this is considered to be a hacky workaround in the Oracle world, but that was told to me in a "friend of a friend" kind of way. How big a deal is it to use triggers to increment primary keys from a sequence instead of using the sequence directly?


Solution

  • It is a very common practice in my experience, and not a terribly bad one. However, if you have control over the inserts (e.g. if all inserts are done via a PL/SQL API) then it is more efficient to use the sequence directly in the INSERT statement - because it avoids the overhead of firing a trigger. But I really wouldn't worry unduly about it if you have used triggers!